PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C009265P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 341aa    MW: 36145.1 Da    PI: 9.8407
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C009265P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.8e-3978137362
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     e+alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+++
  MELO3C009265P1  78 EAALKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRTK 137
                     7789*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1014473.92E-54148No hitNo description
ProDomPD0074781.0E-3661135IPR003851Zinc finger, Dof-type
PfamPF027011.5E-3280135IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.54481135IPR003851Zinc finger, Dof-type
PROSITE patternPS01361083119IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MNFSSIPPYL DPSNWQQQVT HQVGTSSSTA VSSQLLPPPP PPPPPPPPPP PHGIGGAGSI  60
RPGSMAERAR MANIPMPEAA LKCPRCESTN TKFCYFNNYS LTQPRHFCKT CRRYWTRGGA  120
LRNVPVGGGC RRNKRTKGSS SKSPPVSSDR QQTSGSANSS SSAIASNNSG GLSPQIPPLG  180
RFMAPLHQQL SDFDIGSYSY GGGLSAPATA TGDLNFHLGN TNLGGGTSIG SLLGFDQQQW  240
RLQQQPPQFP FLSSLDPFEG GNGGGGEAPG TGWPMRPKVP SRNNLTQMGN SVKMEETPDQ  300
VNNNVGRQLI GNNEQYWSSG SMAWSDLSGF SSSSSTRNPL *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00295DAPTransfer from AT2G37590Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008442559.10.0PREDICTED: dof zinc finger protein DOF5.1-like
SwissprotO809281e-53DOF24_ARATH; Dof zinc finger protein DOF2.4
TrEMBLA0A0A0LAK90.0A0A0A0LAK9_CUCSA; Uncharacterized protein
STRINGVIT_08s0007g00180.t012e-85(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.13e-50DNA binding with one finger 2.4